PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P03880_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 241aa    MW: 27636.9 Da    PI: 10.128
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P03880_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-183682148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT eEd +l +avkq+ g++Wk+Ia+ ++ gRt+ qc +rwqk+l
  GSMUA_Achr2P03880_001 36 KGGWTNEEDAILSRAVKQFDGRNWKRIAEAFP-GRTDIQCLHRWQKVL 82
                           688*****************************.************986 PP

2Myb_DNA-binding59.95.7e-1988134148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEde ++++v+++G ++W+ Ia+ +  gR +kqc++rw+++l
  GSMUA_Achr2P03880_001  88 KGSWTKEEDECIIKLVAKHGCKRWSIIAKSLS-GRIGKQCRERWYNHL 134
                            799*****************************.*************97 PP

3Myb_DNA-binding521.6e-16140182145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            +++WT+eE+  l+ a+k++G++ W+ Ia+++  gR ++++k++w+
  GSMUA_Achr2P03880_001 140 KDAWTPEEEVTLIYAHKKYGNK-WAEIAKHLH-GRAENSIKNHWN 182
                            689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.43182IPR017930Myb domain
SuperFamilySSF466896.14E-163488IPR009057Homeodomain-like
SMARTSM007171.2E-153584IPR001005SANT/Myb domain
PfamPF002495.1E-153682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-233898IPR009057Homeodomain-like
CDDcd001673.98E-133982No hitNo description
PROSITE profilePS5129430.15283138IPR017930Myb domain
SuperFamilySSF466891.21E-3085181IPR009057Homeodomain-like
SMARTSM007171.9E-1687136IPR001005SANT/Myb domain
PfamPF002498.6E-1888134IPR001005SANT/Myb domain
CDDcd001674.11E-1590134No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2699142IPR009057Homeodomain-like
PROSITE profilePS5129419.699139189IPR017930Myb domain
SMARTSM007171.1E-14139187IPR001005SANT/Myb domain
PfamPF002491.4E-14140182IPR001005SANT/Myb domain
CDDcd001678.78E-11142182No hitNo description
Gene3DG3DSA:1.10.10.601.3E-22143189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGPYSCGILY MIGIMIVVFS PYIFRKISGP TRRSTKGGWT NEEDAILSRA VKQFDGRNWK  60
RIAEAFPGRT DIQCLHRWQK VLNPELVKGS WTKEEDECII KLVAKHGCKR WSIIAKSLSG  120
RIGKQCRERW YNHLNPAIKK DAWTPEEEVT LIYAHKKYGN KWAEIAKHLH GRAENSIKNH  180
WNCSLKKKLA SYLSSKSFDQ PSGGSLSFCS CGFTPTVMRY ANCELVFDGR SRSLNTVMND  240
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-67361896159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-67361896159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009383798.11e-130PREDICTED: uncharacterized protein LOC103971496 isoform X1
RefseqXP_009383804.11e-131PREDICTED: myb-related protein 3R-1-like isoform X2
SwissprotQ9S7G74e-82MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLM0S4X90.0M0S4X9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P03880_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.27e-79Homeodomain-like protein